PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00661.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 387aa    MW: 44313.3 Da    PI: 6.9834
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00661.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52151431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd++   ++ +  +++wyfFs++dkky+tg+r+nrat++g+W
  Sme2.5_00661.1_g00008.1  15 VPPGFRFHPTEEELLHYYLRKKVAYEKIDL-DVIRDVDLNKLEPWDIQDkcRIGStPQNDWYFFSHKDKKYPTGTRTNRATTAGFW 99 
                              69****************************.9***************952433332456*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Sme2.5_00661.1_g00008.1 100 KATGRDKVIHS-NSKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                              *********99.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5811173IPR003441NAC domain
PROSITE profilePS5100556.57815173IPR003441NAC domain
PfamPF023651.5E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MSKDMNLSVN GQSQVPPGFR FHPTEEELLH YYLRKKVAYE KIDLDVIRDV DLNKLEPWDI  60
QDKCRIGSTP QNDWYFFSHK DKKYPTGTRT NRATTAGFWK ATGRDKVIHS NSKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNIDIP LKTNANESSN QEEGWVVCRV FKKKNYHKAL  180
ESPQSSSSAL SRSSALIQKP NNDAVLDQIL MYMGRSCKQQ DLESKHNNSL LNNIHLDDHI  240
MQINNTNSFM INNNVNRFIH LPGLDNHHSP TNNMEDVSSL QLIQQADCCS FDETLTETHP  300
KSGLGEMRWS HTSTGSGPSD WASLDRLVAS QLNGHDHVEN ISSNNNLCFP LHHHRKPNDD  360
DDVDVEFWSY ARSSSPSPSD PLCHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-491217514167NAC domain-containing protein 19
4dul_A1e-491217514167NAC domain-containing protein 19
1ut7_B1e-491217514167NO APICAL MERISTEM PROTEIN
1ut7_A1e-491217514167NO APICAL MERISTEM PROTEIN
1ut4_B1e-491217514167NO APICAL MERISTEM PROTEIN
1ut4_A1e-491217514167NO APICAL MERISTEM PROTEIN
3swp_D1e-491217517170NAC domain-containing protein 19
3swp_C1e-491217517170NAC domain-containing protein 19
3swp_B1e-491217517170NAC domain-containing protein 19
3swp_A1e-491217517170NAC domain-containing protein 19
3swm_D1e-491217517170NAC domain-containing protein 19
3swm_C1e-491217517170NAC domain-containing protein 19
3swm_B1e-491217517170NAC domain-containing protein 19
3swm_A1e-491217517170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565041.10.0PREDICTED: NAC domain-containing protein 43-like
RefseqXP_016565056.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-118NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1AVV20.0M1AVV2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000315710.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-104NAC family protein